SNPS to Networks 1: KEGG¶

Downloading Zea mays data from the KEGG database.

In [ ]:
#| default_exp kegg
In [ ]:
#| hide
# from nbdev.showdoc import *
In [ ]:
import os
import tqdm
from tqdm import tqdm
import re
import time
import sys
import requests
import numpy as np
import pandas as pd
import plotly.express as px

Helpful Custom Functions¶

In [ ]:
#| export

"Iteratively check for and create directories to store output. Ideally this would just be os.mkdirs() but that function is not available in this version of python"
def ensure_dir_path_exists(dir_path = '../ext_data'):
    import os
    
    for i in range(2, len(dir_path.split('/'))+1):
        path_part = '/'.join(dir_path.split('/')[0:i])
        if not os.path.exists(path_part):
            os.mkdir(path_part)
        
In [ ]:
#| export

"Retrieve a previously calculated result. Return None if it cannot be found."
def get_cached_result(
    save_path
):
    import os
    import pickle as pkl
    if not os.path.exists(save_path):
        cached_result = None
    else:
        with open(save_path, 'rb') as handle:
                cached_result = pkl.load(handle)
    return(cached_result)
In [ ]:
#| export

def put_cached_result(
    save_path,
    save_obj
):
    import pickle as pkl
    from dlgwas.kegg import ensure_dir_path_exists
    ensure_dir_path_exists(dir_path= '/'.join(save_path.split('/')[:-1]) )
    
    with open(save_path, 'wb') as handle:
            pkl.dump(save_obj, 
                     handle, 
                     protocol=pkl.HIGHEST_PROTOCOL)
In [ ]:
 
In [ ]:
# # This is the expected boiler plate for using the above functions. 

# save_path = './demofile.txt'

# demo = get_cached_result(save_path=save_path)

# if None == samples_and_matches:
#     demo = CODE TO MAKE DEMO HERE
    
#     put_cached_result(
#         save_path = save_path,
#         save_obj = demo
#     )
In [ ]:
 

Identify genes to be downloaded:¶

In [ ]:
#| export

# Get all the genes for zea mays
# Some gene entries that don't start begin with a chromosome number. These included plastid (Pltd) and mitochondria (MT) genes.

def get_kegg_species_list(species = 'zma'):
    import os
    import requests
    # make sure the directory exists to hold these data
    ensure_dir_path_exists(dir_path = '../ext_data/'+species+'/kegg')

    file_path = '../ext_data/'+species+'/kegg'+'/'+species+'_list.txt'
    # only retrieve if there isn't a local copy
    if file_path.split('/')[-1] in os.listdir('/'.join(file_path.split('/')[:-1])):
        with open(file_path, 'r') as f:
            r_text = f.read()
    else:
        r = requests.get('https://rest.kegg.jp/list/'+species)
        r_text = r.text
        with open(file_path, 'a') as f:
            f.write(r_text)
    return(r_text)
In [ ]:
#| export
def mkdf_kegg_species_list(kegg_species_list):
    import pandas as pd
    kegg_list_zma = pd.DataFrame([e.split('\t') for e in kegg_species_list.split('\n') ])
    # clean up names
    kegg_list_zma = kegg_list_zma.rename(columns = dict(zip(
        [i for i in range(4)],
        ['gene', 'seq_type', 'chromosome_positon', 'gene_type']
    )))

    kegg_list_zma = kegg_list_zma.loc[kegg_list_zma.chromosome_positon.notna(), ]
    return(kegg_list_zma)

The KEGG list contains a gene id that can be used to download further information. The chromosomal position will be key to match up collected SNPs to genes.

In [ ]:
kegg_zma_list = get_kegg_species_list(species = 'zma')
kegg_list_zma = mkdf_kegg_species_list(kegg_species_list = kegg_zma_list)

There are also entries that don't start with a chromosome number. These are non-nuclear sequences from plastid (Pltd), Mitochondria (MT), etc.

In [ ]:
no_chrm = [e for e in kegg_list_zma['chromosome_positon'] if re.match('\D.+', e)]
no_chrm = list(set(no_chrm))
kegg_list_zma.loc[kegg_list_zma.chromosome_positon.isin(no_chrm), ]
Out[ ]:
gene seq_type chromosome_positon gene_type
35639 zma:845199 CDS Pltd:complement(89..1150) psbA, ZemaCp002; photosystem II protein D1
35640 zma:845256 tRNA Pltd:complement(1386..3946) trnK, ZemaCt121; tRNA-Lys
35641 zma:845178 CDS Pltd:complement(1674..3215) matK, ZemaCp003; maturase K
35642 zma:845232 CDS Pltd:complement(4491..5604) rps16, ZemaCp004; ribosomal protein S16
35643 zma:845265 tRNA Pltd:complement(6773..6844) trnQ, ZemaCt122; tRNA-Gln
... ... ... ... ...
37707 zma:118475995 rRNA Unknown 28S ribosomal RNA
37708 zma:118475996 rRNA Unknown 5.8S ribosomal RNA
37709 zma:5951366 CDS MT pBMSmt19_00005; hypothetical protein
37710 zma:5951368 CDS MT pBMSmt19_00010; hypothetical protein
37711 zma:5951367 CDS MT pBMSmt19_00015; hypothetical protein

2066 rows × 4 columns

Download and cache KEGG entries¶

In [ ]:
#| export

def download_kegg_gene(kegg_gene = 'zma:103644366', **kwargs):    
    """
    Downloads kegg gene entry if it does not exist locally. 
    Can optionally take a numeric value as `sleep_for` to sleep after downloading a file. 
    Useful for controlling the rate requests being sent to the API.
    """
    species = kegg_gene.split(':')[0]
    dir_path = '../ext_data/'+species+'/kegg/gene_entries/'
    ensure_dir_path_exists(dir_path = dir_path)
    
    kegg_gene_safename = kegg_gene.replace(':', '_') # name that's safe for file names
    file_path = dir_path+kegg_gene_safename+'.txt'
    
    # only download if the file doesn't already exist
    if os.path.exists(file_path):
        pass
    else:
        # option to sleep for a given amount of time so tha tthe api isn't accessed to much
        # sleeping here means that we only sleep if there will be a request to download
        if 'sleep_for' in kwargs.keys():
            time.sleep(kwargs['sleep_for'])
        
        r = requests.get('https://rest.kegg.jp/get/'+kegg_gene)
        with open(file_path, 'a') as f:
            f.write(r.text)
In [ ]:
#| export
def read_kegg_gene(
    kegg_gene = 'zma:103644366',
    **kwargs # Intended to allow for explicit 'encoding' to be passed into open the file : encoding="ISO-8859-1"
    ):  
    "Reads in locally cached KEGG gene entries. Will download the requested entry if it doesn't exist locally."
    import os
    species = kegg_gene.split(':')[0]
    dir_path = '../ext_data/'+species+'/kegg/gene_entries/'
    ensure_dir_path_exists(dir_path = dir_path)
    
    kegg_gene_safename = kegg_gene.replace(':', '_') # name that's safe for file names
    file_path = dir_path+kegg_gene_safename+'.txt'

    if not os.path.exists(file_path):
        download_kegg_gene(kegg_gene)
    
    if 'encoding' in kwargs.keys():
        with open(file_path, encoding  = kwargs['encoding']) as f:
            r_text = f.read()        
    else:
        with open(file_path) as f:
            r_text = f.read()
            
    return(r_text)

Example usage for one gene. Species is inferred and if it doesn't exist in ext_data then it will automatically be downloaded with download_kegg_gene().

In [ ]:
print(read_kegg_gene(kegg_gene = 'zma:103644366'))
ENTRY       103644366         CDS       T01088
NAME        (RefSeq) uncharacterized protein LOC103644366
ORTHOLOGY   K15032  mTERF domain-containing protein, mitochondrial
ORGANISM    zma  Zea mays (maize)
BRITE       KEGG Orthology (KO) [BR:zma00001]
             09180 Brite Hierarchies
              09182 Protein families: genetic information processing
               03012 Translation factors [BR:zma03012]
                103644366
               03029 Mitochondrial biogenesis [BR:zma03029]
                103644366
            Translation factors [BR:zma03012]
             Eukaryotic type
              Release factors
               103644366
            Mitochondrial biogenesis [BR:zma03029]
             Mitochondrial DNA transcription, translation, and replication factors
              Mitochondrial transcription and translation factors
               Mitochondrial translation factors
                103644366
POSITION    1:34607..40208
MOTIF       Pfam: mTERF
DBLINKS     NCBI-GeneID: 103644366
            NCBI-ProteinID: XP_020400304
AASEQ       644
            MPWIMHAGTEQRHAACGASLLWSSLQPSTVVMAAAAATFGFLHPPIRKPAVPPLYILRLP
            TKPHSKTHPRSPPLLFLLLGRRRGGPIAAFPNTTSSSTNAPASPTYDVREAEAAVADLLR
            EGGASADDAASIAARAPAYAAMLADGVRELDELGLWASWSSGARARLGLSGVVEMEMGRL
            GFRRKVYLMGRSKPDHGVVPLLESLGMRLSSAKLIAPYVAAAGLTVLIDRVKFLKEMLFS
            SSDYAILIGRNAKRMMTYLSIPADDALQSTLSFFEKMEARYGGVSMLGHGDVSFPYLIES
            FPMLLLCSEDNHLKPLVDFLEHIGIPKPKIASVLLLFPPIILSDVENDIKPRIREWEKAG
            IEQDYVSRMLLKYPWILSTSVIENYSQMLLFFNQKRISSTVLAIAVKSWPHILGSSSKRM
            NSVLELFHVLGISKKMVVPVITSSPQLLLRKPDQFMQNVLFFREMGVDKKTTGKILCRSP
            EIFASNVDNTLKKKIDFLTNFGVSKHHLPRIIRKYPELLLLDINCTLLPRMNYLLEMGLS
            KKDLCSMIFRFSPLLGYSIELVMKPKLEFLLRTMKKPLKAVVEYPRYFSYSLEGKIKPRF
            WVLQSRNIDCTLTEMLAKNDELFAEEYLGLGGLLEKPLQSSIGS
NTSEQ       1935
            atgccatggataatgcacgcgggaacggaacaaagacacgcggcgtgcggggcctcgctc
            ctctggtcttccctccagccctcgacggtggtcatggccgccgccgccgccactttcggc
            ttcctccatcctccaatccggaaacctgcagtcccaccactgtacattctccggcttccc
            accaaaccccactccaaaacgcaccctcgttctccccccctcctcttcctcctcctgggc
            cgccgccggggaggccccatcgccgccttccccaacaccacatcttcatccacgaatgcc
            cctgcctcgcccacctacgacgtccgggaggcagaggccgccgtcgcggatctcctccgc
            gagggcggcgcctccgcggacgacgccgcctccatcgccgcgcgcgcgccggcctacgcc
            gctatgctcgccgatggcgtccgcgagctggacgagcttggcctctgggcgtcgtggagc
            tccggtgccagggcccggctgggcctcagcggggtcgtcgagatggagatggggaggctc
            ggttttaggaggaaggtgtatctcatgggacggagcaagcctgaccacggcgtggtgccg
            ctcctcgagagcttgggaatgcgtctctcctcggccaaactcatcgcgccttacgtcgcg
            gctgcgggccttactgtgctgattgatagggttaagtttttgaaggaaatgttattttca
            agcagtgattatgcaatactaattggaaggaatgctaagcggatgatgacatacttatca
            atacctgcagatgatgcactccaaagtactttatctttttttgaaaaaatggaggctagg
            tatggtggtgttagcatgttgggacatggagatgtgtcatttccttacctcattgaatca
            tttccgatgcttcttctctgctcagaagataatcatctcaagccgttagttgattttctc
            gagcacattggaattccaaagccaaagattgcatcagttctgctgctatttcctcctatc
            attctttctgatgttgaaaatgatattaagcctaggattcgtgaatgggagaaggctggc
            attgaacaagactatgttagtaggatgttgttgaagtatccatggattctttcaacgagt
            gtgatagagaactacagtcaaatgctgttgtttttcaaccaaaaaaggatttccagtaca
            gtcctcgctattgctgtgaaaagttggcctcatattcttggctcctcttcaaaaagaatg
            aattcagttttggagctgtttcatgttctgggcatcagtaaaaaaatggtggttccagtc
            attacatcaagtccacagttattactgagaaaacctgatcagtttatgcagaatgttttg
            tttttcagagaaatgggtgttgataagaaaacaacaggaaaaattctgtgtcgttcgcct
            gaaatatttgcttcaaacgtggataacaccctcaagaagaaaatcgattttcttaccaac
            tttggtgtttctaaacatcatcttcctcgcatcattcggaagtatccagaacttttattg
            ttggacataaattgtacattgctccctaggatgaactacttattggagatgggtttgtct
            aagaaagatctgtgctcaatgatctttagattttccccacttctaggttacagtattgaa
            cttgttatgaaaccaaagcttgagtttctgctaagaaccatgaagaagccacttaaagca
            gttgtagaatacccaaggtacttcagttattcactcgaggggaagatcaaaccgcggttc
            tgggtattgcagagtagaaacatagactgcactctgacagagatgttagcaaagaacgat
            gaactctttgctgaagagtacttgggacttggaggattgctcgagaaacctctacaatca
            agcataggcagttaa
///

To cache all genes on KEGG for an organism, loop over all entries in the KEGG list for that species.

In [ ]:
for kegg_gene in tqdm(kegg_list_zma.gene):
    try:
        download_kegg_gene(kegg_gene = kegg_gene, 
                           sleep_for = np.random.uniform(0.5, 1.5))
    except:
        print('Problem with '+kegg_gene) 
100%|█████████████████████████████████████| 37712/37712 [00:00<00:00, 86701.77it/s]

Imported from 02¶

In [ ]:
# # import tqdm
# import os, re
import pickle as pkl

# import dlgwas
# from dlgwas.core import *

Load Zea mays gene list¶

In [ ]:
kegg_zma_list = get_kegg_species_list(species = 'zma')
In [ ]:
kegg_zma_list = get_kegg_species_list(species = 'zma')
In [ ]:
kegg_list_zma = mkdf_kegg_species_list(kegg_species_list = kegg_zma_list)
In [ ]:
kegg_list_zma.head()
Out[ ]:
gene seq_type chromosome_positon gene_type
0 zma:103644366 CDS 1:34607..40208 uncharacterized protein LOC103644366
1 zma:100382519 CDS 1:complement(41254..46100) uncharacterized protein LOC100382519
2 zma:103649349 CDS 1:complement(92293..107876) protein FAR1-RELATED SEQUENCE 5-like
3 zma:115032971 CDS 1:complement(187229..189591) uncharacterized protein LOC115032971
4 zma:103630223 CDS 1:complement(200404..203170) granule-bound starch synthase 1b, chloroplasti...

Read KEGG gene entries¶

Convert a single file into a dictionary¶

The gene files contain sections (ENTRY, NAME, AASEQ, etc.). To aid processing each of these sections will be separated into a key in a dictionary.

In [ ]:
kegg_file = 'zma_100125650.txt'
# convert back to KEGG format
kegg_gene_name = kegg_file.replace('_', ':').replace('.txt', '')

# convert back to kegg format
r_text = read_kegg_gene(kegg_gene = kegg_gene_name)

# parsing gene entry
r_text_list = r_text.split('\n')
r_text_list[0:5]
Out[ ]:
['ENTRY       100125650         CDS       T01088',
 'NAME        (RefSeq) barren inflorescence 2',
 'ORGANISM    zma  Zea mays (maize)',
 'POSITION    1:177940567..177942323',
 'MOTIF       Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal']
In [ ]:
# Some files may not contain all sections so this list needs to be created for each file
section_names = [r_text_list[i][0:12].strip() for i in range(len(r_text_list)) ]
section_names = [e for e in section_names if e != '']

section_starts = [
    [i for i in range(len(r_text_list)) if re.match('^'+e, r_text_list[i])][0] 
    for e in section_names]

section_names, section_starts
Out[ ]:
(['ENTRY',
  'NAME',
  'ORGANISM',
  'POSITION',
  'MOTIF',
  'DBLINKS',
  'AASEQ',
  'NTSEQ',
  '///'],
 [0, 1, 2, 3, 4, 5, 8, 18, 44])
In [ ]:
# just split each file into text of it's sections
out = {}

# get lines associated with section
def _get_section_text(section_name = 'AASEQ'):
    idx = section_names.index(section_name)
    section_text = r_text_list[section_starts[idx]:section_starts[idx+1]]
    # remove leading indent
    section_text = [e[12:] for e in section_text]
    return(section_text)

for section_name in section_names:
    if section_name != '///': # end of file
        out[section_name] = _get_section_text(section_name = section_name)
In [ ]:
out
Out[ ]:
{'ENTRY': ['100125650         CDS       T01088'],
 'NAME': ['(RefSeq) barren inflorescence 2'],
 'ORGANISM': ['zma  Zea mays (maize)'],
 'POSITION': ['1:177940567..177942323'],
 'MOTIF': ['Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal'],
 'DBLINKS': ['NCBI-GeneID: 100125650',
  'NCBI-ProteinID: NP_001106051',
  'UniProt: A6MW92'],
 'AASEQ': ['491',
  'MDAAVRVPPALGNKTVTEVTPPPPPPAGEERLSDADTTASSTAAPNSSLSSASSAASLPR',
  'CSSLSRLSFDCSPSAALSSSSAAAAAAAASSPAPAPARPHRAGDAAWAAIRAASASAAAP',
  'LGPRDFRLLRRVGGGDVGTVYLCRLRAPPAPAPVCCLYAMKVVDRRVAAAKKKLEHAAAE',
  'RRILRALDHPFLPTLFADFDAAPHFSCVVTEFCPGGDLHSLRHRMPNRRFPLPSARFYAA',
  'EVLLALEYLHMMGIVYRDLKPENVLIRADGHIMLTDFDLSLQCTSTPSLEPCAAPEAAAA',
  'SCFPDHLFRRRRARLRRAASARRPPTTLVAEPVEARSCSFVGTHEYVAPEVARGGPHGAA',
  'VDWWALGVFLYELLHGRTPFAGADNEATLRNIARRPLSFPAAGAGDADARDLIARLLAKD',
  'PRHRLGSRRGAADVKAHPFFRGLNFALLRSSRPPVVPAASRSPLHRSQSCSAARTRASKP',
  'KPPPDTRFDLF'],
 'NTSEQ': ['1476',
  'atggacgccgcggtgcgcgtccccccggcgctcgggaacaagacggtgaccgaggtgacg',
  'ccgccgccgccaccaccggcgggggaggagcggctgtcggacgccgacacgacggcgtcg',
  'tcgacggcggcgcccaactcgagcctcagctcggccagcagcgccgccagcctgccgcgc',
  'tgctccagcctgtcccgcctctccttcgactgctctccgtccgcggccctgtcctcttcc',
  'tcggcggcggcggcggccgcggccgcgtcatcgccggcgccagcgccggcgcggccgcac',
  'cgggcaggggacgcggcgtgggcggcgatccgcgcggcgtcggcgtcggccgcggcgccg',
  'ctggggccgcgggacttcaggctgctgcgccgcgtgggcggcggcgacgtcggcaccgtg',
  'tacctgtgccgcctcagggcgccacccgcgcccgcgcccgtctgctgcctgtacgcgatg',
  'aaggtggtggaccggcgcgtggcggccgcgaagaagaagctggagcacgcggcggcggag',
  'cggcggatcctgcgggcgctggaccatccgttcctgcccacgctcttcgccgacttcgac',
  'gccgcgccgcacttctcctgcgtcgtcacggagttctgccccggcggggacctccactcg',
  'ctccgccaccgcatgcccaaccgccgcttcccgctcccgtcagctcggttctacgcggcg',
  'gaggtgttgctggcgctggagtacctgcacatgatgggcatcgtgtaccgcgacctcaag',
  'ccggagaacgtgctgatccgcgcggacggccacatcatgctcacggacttcgacctgtcg',
  'ctgcagtgcacgtcgacgccgtcgctcgagccgtgcgccgcccccgaggcggcggcggcg',
  'tcctgcttcccggaccacctgttccgccgccggcgcgcgcgactccgccgtgccgcctcg',
  'gcgcggcggccgccaacgaccctggtggcggagccggtggaggcgcggtcgtgctcgttc',
  'gtgggcacgcacgagtacgtggcgcccgaggtggcccgcggcgggccccacggcgcggcc',
  'gtcgactggtgggcgctcggcgtgttcctgtacgagctcctgcacgggcgcaccccgttc',
  'gcgggcgccgacaacgaggccacgctccgcaacatcgcgcgccgcccgctgtccttcccc',
  'gctgccggcgccggtgatgccgacgcgcgcgacctcatcgcccgcctcctcgccaaggac',
  'ccgcgccaccggttggggtcccggcgcggcgccgccgacgtgaaggcgcacccgttcttc',
  'cgcgggctcaacttcgcgctgctccggtcctcccgcccgcccgtcgtccccgccgcgtcg',
  'cgctccccgctgcaccgctcgcagtcctgcagcgcggcgcgcacgagagcgtcgaagccg',
  'aagccgccgccggacacccggttcgacctgttctga']}

Convert all downloaded gene files¶

In [ ]:
def kegg_gene_to_dict(kegg_file = 'zma_100125650.txt',
                     **kwargs):
    # convert back to kegg format
    if 'encoding' in kwargs.keys():
        r_text = read_kegg_gene(
            kegg_gene= kegg_file.replace('_', ':').replace('.txt', ''),
            encoding  = kwargs['encoding']
        )
    else:
        r_text = read_kegg_gene(
            kegg_gene= kegg_file.replace('_', ':').replace('.txt', '') )
    
    # parsing gene entry
    r_text_list = r_text.split('\n')

    # Some files may not contain all sections so this list needs to be created for each file
    section_names = [r_text_list[i][0:12].strip() for i in range(len(r_text_list)) ]
    section_names = [e for e in section_names if e != '']

    section_starts = [
        [i for i in range(len(r_text_list)) if re.match('^'+e, r_text_list[i])][0] 
        for e in section_names]

    # just split each file into text of it's sections
    out = {}

    # get lines associated with section
    def _get_section_text(section_name = 'AASEQ'):
        idx = section_names.index(section_name)
        section_text = r_text_list[section_starts[idx]:section_starts[idx+1]]
        # remove leading indent
        section_text = [e[12:] for e in section_text]
        return(section_text)

    for section_name in section_names:
        if section_name != '///': # end of file
            out[section_name] = _get_section_text(section_name = section_name)

    return(out)
In [ ]:
save_dir = '../data/zma/kegg/'
save_path = save_dir+'cached_kegg_gene_files.pkl'

ensure_dir_path_exists(dir_path = save_dir)
In [ ]:
# 27258 zma_100037738.txt

# kegg_gene_to_dict(
#             kegg_file = 'zma_100037738.txt',
# #             encoding="ISO-8859-1"
#         )
In [ ]:
# kegg_gene_files = os.listdir('../ext_data/zma/kegg/gene_entries/')

# lst_out = []

# for i in range(len(kegg_gene_files)):
#     kegg_gene_file = kegg_gene_files[i]
#     print(i, kegg_gene_file)
#     lst_out += [    
#         kegg_gene_to_dict(
#             kegg_file = kegg_gene_file,
#             encoding="ISO-8859-1"
#         )]
In [ ]:
if not os.path.exists(save_path):
    # This is a pain. I would like to parallelize reading these files in, but since it only has to be done once per species doing so would be premature optimization.
    # BUT it seems that nbdev is rerunning it as part of the CI workflow. So caching it makes sense. 
    kegg_gene_files = os.listdir('../ext_data/zma/kegg/gene_entries/')
#     kegg_gene_entries = [kegg_gene_to_dict(kegg_file = kegg_gene_file) for kegg_gene_file in tqdm.tqdm(kegg_gene_files)]
    kegg_gene_entries = [kegg_gene_to_dict(
        kegg_file = kegg_gene_file,
        encoding="ISO-8859-1"
    ) for kegg_gene_file in kegg_gene_files]
    # 37712/37712 [07:12<00:00, 87.23it/s]

    with open(save_path, 'wb') as handle:
        pkl.dump(kegg_gene_entries, 
                 handle, 
                 protocol=pkl.HIGHEST_PROTOCOL)
else:
    # Reading in data
    with open(save_path, 'rb') as handle:
        kegg_gene_entries = pkl.load(handle)

Clean up KEGG gene dictionaries¶

The goal here is to use a finite-state machine to convert the lines for each section into a useful representation. This approach makes extending or altering this code easier.

Starting out I needed to find how many states were featured across all files.

In [ ]:
# produce a flat list of keys then deduplicate them
kegg_gene_sections = [entry for sublist in [list(kegg_gene_entries[i].keys()) for i in range(len(kegg_gene_entries))] 
                  for entry in sublist] # entry is defined here so without it the list comprehension fails instead of producing the list of sublists
kegg_gene_sections = list(set(kegg_gene_sections))
kegg_gene_sections 
Out[ ]:
['NTSEQ',
 'ORTHOLOGY',
 'DBLINKS',
 'BRITE',
 'ORGANISM',
 'PATHWAY',
 'AASEQ',
 'MOTIF',
 'SYMBOL',
 'ENTRY',
 'MODULE',
 'NAME',
 'POSITION',
 'STRUCTURE']

To aid in writing the logic for each section, pull several examples as a reference.

In [ ]:
# Helper Functions ---------------------------------------------------------------------
# helper fcn to pull indices and examples of sections
def get_section_examples(section = 'MOTIF', n = 5):
    i_section_matches = [i for i in range(len(kegg_gene_entries)) if section in kegg_gene_entries[i].keys()]
    out = [[i_section_matches[i], 
            kegg_gene_entries[i_section_matches[i]][section] ] for i in range(n)]
    return(out)
In [ ]:
get_section_examples(section = 'SYMBOL', n = 5)
Out[ ]:
[[89, ['MIR395l']],
 [100, ['lox6']],
 [133, ['HDA108']],
 [147, ['MIR169o']],
 [167, ['MIR169p']]]

Now create a function to process each section of the file or more precisely, each section type that needs a different treatment.

In [ ]:
# Any non-hierarical list of attributes can go here. It will be transformed into a dict
def _gene_entry_flat_list(section_entry):
    # split like so [['NCBI-GeneID', '103644366'], ['NCBI-ProteinID', 'XP_020400304']]
    # then convert to dict
    # {'NCBI-GeneID': '103644366', 'NCBI-ProteinID': 'XP_020400304'}
    section_entry = [e.replace(section_name, '').strip().split(': ') for e in section_entry]
    section_entry = dict(section_entry)
    return(section_entry)
In [ ]:
# 'AASEQ', 'NTSEQ'
def _gene_seq_to_dict(seq_list):
    out = {}
    out['lenght'] = int(seq_list[0])
    out['seq'] = ''.join(seq_list[1:])
    return(out)

The hardest one to think through was the "BRITE". This section contains a tree categorizing the gene's role(s). Here's a sample excerpt:

KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100037782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:zma03021]
    100037782
# ...

The goal is to represent these data in a way that can be used to construct a hierarchy for all genes that are in a given sample. Level is defined by leading whitespace.

KEGG Orthology (KO) [BR:zma00001]
├ 09120 Genetic Information Processing
│ └ 09121 Transcription
│   └ 03020 RNA polymerase
│     └ 100037782
└ 09180 Brite Hierarchies
  └ 09182 Protein families: genetic information processing
    └ 03021 Transcription machinery [BR:zma03021]
      └ 100037782

Parsing into a dictionary makes sense (and then creating a full hierarchy would be as simple as merging on keys) but building one is tricky to do since you can't pass a list of keys into a dictionary. Instead of reading from the root to the leaf, we work backwards to find the path from leaf to root. This makes finding the right parent easy -- track the indent level and go up one line skipping lines with an indent level >= the current level. These paths have redundant information (shared parents) but represent what is needed.

In [ ]:
 
In [ ]:
# Figuring out how to process BRITE entries
kegg_gene_entry = kegg_gene_entries[0]
section_entry = kegg_gene_entry['BRITE']

section_entry
Out[ ]:
['KEGG Orthology (KO) [BR:zma00001]',
 ' 09180 Brite Hierarchies',
 '  09183 Protein families: signaling and cellular processes',
 '   02000 Transporters [BR:zma02000]',
 '    100283122',
 'Transporters [BR:zma02000]',
 ' Solute carrier family (SLC)',
 '  SLC50: Sugar efflux transporter',
 '   100283122']
In [ ]:
# get the leading whitespace for each line
indent_spaces = [re.findall('^ +', e)[0] if re.match('^ ', e) else [''][0] for e in section_entry]
indent_spaces = [len(e) for e  in indent_spaces]

len(indent_spaces), indent_spaces
Out[ ]:
(9, [0, 1, 2, 3, 4, 0, 1, 2, 3])

Because the lists are ordered, given a position one can start at a leaf and work back up to the root by walking backwards and looking for the next point at which the indent level is the expected level. IF it's true that each of the leaves contain only an identifer number and no letters then the process is to

  1. Find all leaves
  2. Walk backwards from all leaves
  3. Add a list of lists with these paths (could be used in a tidy format)

Below the process of building up the path from leaf to root and the indents at each step (as a sanity check) are shown.

In [ ]:
i = 4 # position in list
indent = indent_spaces[i] # indent at that position

j = i
current_indent = indent
# work backawards to get the paths
j_backtrack      = [j]
indent_backtrack = [current_indent]

while indent_backtrack[-1] > 0:
    while current_indent != indent_backtrack[-1]-1:
        j = j-1
        current_indent = indent_spaces[j]

    j_backtrack.extend([j])
    indent_backtrack.extend([current_indent])

    # indent
    print(j_backtrack, indent_backtrack) # 
[4, 3] [4, 3]
[4, 3, 2] [4, 3, 2]
[4, 3, 2, 1] [4, 3, 2, 1]
[4, 3, 2, 1, 0] [4, 3, 2, 1, 0]

Wrap this in a function, then integrate into a processing function for BRITE

In [ ]:
def _indent_backtrack_path(i, # position in list 
                           indent_spaces                                        
                          ):
    indent = indent_spaces[i] # indent at that position
    j = i
    current_indent = indent
    # work backawards to get the paths
    j_backtrack      = [j]
    indent_backtrack = [current_indent]

    while indent_backtrack[-1] > 0:
        while current_indent != indent_backtrack[-1]-1:
            j = j-1
            current_indent = indent_spaces[j]

        j_backtrack.extend([j])
        indent_backtrack.extend([current_indent])
        
    # indent_backtrack is not needed beyond debugging
    # confirm that the indent only decreases as you walk through the backtrack
    indent_check = indent_backtrack[1:]+[-1]
    indent_check =  [True if indent_backtrack[i] > indent_check[i] else False for i in range(len(indent_backtrack))]
    assert False not in indent_check
    
    return(j_backtrack)
In [ ]:
def _gene_entry_BRITE(section_entry):
    # get the leading whitespace for each line
    indent_spaces = [re.findall('^ +', e)[0] if re.match('^ ', e) else [''][0] for e in section_entry]
    indent_spaces = [len(e) for e  in indent_spaces]

    # find the leaves
    # ['KEGG Orthology (KO) [BR:zma00001]',
    #  ' 09120 Genetic Information Processing',
    #  '  09121 Transcription',
    #  '   03020 RNA polymerase',
    #  '    100037782' <------------- Whitespace followed by digits and no letters
    leaf_idxs = [i for i in range(len(section_entry)) if re.match('^\s+\d+$', section_entry[i])]

    # for each leaf get the backtrack path to the root
    leaf_backtraces = [_indent_backtrack_path(i = leaf_idx, 
                                              indent_spaces = indent_spaces
                                             ) for leaf_idx in leaf_idxs]
    # reverse the inner lists
    [e.reverse()  for e in leaf_backtraces]

    out = [[section_entry[i] for i in leaf_backtraces[j]] for j in range(len(leaf_backtraces))]
    # sample input
    # ['KEGG Orthology (KO) [BR:zma00001]',
    #  ' 09120 Genetic Information Processing',
    #  '  09121 Transcription',
    #  '   03020 RNA polymerase',
    #  '    100037782',
    #  ' 09180 Brite Hierarchies',
    #  '  09182 Protein families: genetic information processing',
    #  '   03021 Transcription machinery [BR:zma03021]',
    #  '    100037782',
    #  'Enzymes [BR:zma01000]',
    #  ' 2. Transferases',
    #  '  2.7  Transferring phosphorus-containing groups',
    #  '   2.7.7  Nucleotidyltransferases',
    #  '    2.7.7.6  DNA-directed RNA polymerase',
    #  '     100037782',
    #  'Transcription machinery [BR:zma03021]',
    #  ' Eukaryotic type',
    #  '  RNA polymerase II system',
    #  '   RNA polymerase II',
    #  '    Pol IV and V specific subunits',
    #  '     100037782']

    # Sample output
    # [['KEGG Orthology (KO) [BR:zma00001]',
    #   ' 09120 Genetic Information Processing',
    #   '  09121 Transcription',
    #   '   03020 RNA polymerase',
    #   '    100037782'],
    #  ['KEGG Orthology (KO) [BR:zma00001]',
    #   ' 09180 Brite Hierarchies',
    #   '  09182 Protein families: genetic information processing',
    #   '   03021 Transcription machinery [BR:zma03021]',
    #   '    100037782'],
    #  ['Enzymes [BR:zma01000]',
    #   ' 2. Transferases',
    #   '  2.7  Transferring phosphorus-containing groups',
    #   '   2.7.7  Nucleotidyltransferases',
    #   '    2.7.7.6  DNA-directed RNA polymerase',
    #   '     100037782'],
    #  ['Transcription machinery [BR:zma03021]',
    #   ' Eukaryotic type',
    #   '  RNA polymerase II system',
    #   '   RNA polymerase II',
    #   '    Pol IV and V specific subunits',
    #   '     100037782']]

    # and then strip whitespace
    out = [[ee.strip() for ee in e] for e in out]
    return(out)
In [ ]:
def parse_kegg_gene_entry(kegg_gene_entry):
    for section in kegg_gene_entry.keys():
        if type(kegg_gene_entry[section]) != list :
            # This is a safeguard to prevent the code from breaking when rerun. All entries start out as list
            # so if an entry isn't a list then it's already been transformed
            pass

        else:
            if section in ['TEMPLATE']:
                kegg_gene_entry[section] = kegg_gene_entry[section]

            elif section in ['ENTRY', 'NAME', 'ORTHOLOGY', 'ORGANISM', 'POSITION', 'SYMBOL', 'STRUCTURE']:
                kegg_gene_entry[section] = kegg_gene_entry[section][0]

            elif section in ['PATHWAY', 'MODULE']: 
                # NOTE: PATHWAY contains two spaces between the identifier and name which is why I'm not splitting on the first instance of whitespace.
                # 'zma00591  Linoleic acid metabolism'
                #          ^^        ^    ^
                kegg_gene_entry[section] = dict([e.split('  ') for e in kegg_gene_entry[section]])            

            elif section in ['BRITE']:
                # This dict is only expected to have a single key. Representing these data as a dict allows for the 
                # list checking logic above to still work.
                kegg_gene_entry[section] = {"BRITE_PATHS": _gene_entry_BRITE(section_entry = kegg_gene_entry[section])}

#             elif section in ['MODULE']:
#                 pass
#                 kegg_gene_entry[section] = _gene_entry_flat_list(section_entry=kegg_gene_entry[section])
                
            elif section in ['MOTIF', 'DBLINKS']:
                kegg_gene_entry[section] = _gene_entry_flat_list(section_entry=kegg_gene_entry[section])

            elif section in ['AASEQ', 'NTSEQ']:
                kegg_gene_entry[section] = _gene_seq_to_dict(seq_list = kegg_gene_entry[section])

            else:
                print("No behavior defined for "+section)

    return(kegg_gene_entry)
In [ ]:
parsed_kegg_gene_entries = [parse_kegg_gene_entry(kegg_gene_entry = kegg_gene_entry
#                                                  ) for kegg_gene_entry in tqdm.tqdm(kegg_gene_entries)]
                                                 ) for kegg_gene_entry in kegg_gene_entries]

Write out cleaned data¶

In [ ]:
save_dir = '../data/zma/kegg/'

ensure_dir_path_exists(dir_path = '../data/zma/kegg/')
In [ ]:
with open(save_dir+'kegg_gene_entries.pkl', 'wb') as handle:
    pkl.dump(parsed_kegg_gene_entries, 
             handle, 
             protocol=pkl.HIGHEST_PROTOCOL)
    
# Reading in data
# with open('./data/kegg_gene_entries.pkl', 'rb') as handle:
#     kegg_gene_entries = pkl.load(handle)

Visualize KEGG data¶

In [ ]:
# Restrict to only those with pathway
kegg_gene_brite = [e for e in parsed_kegg_gene_entries if 'BRITE' in e.keys()]
In [ ]:
i = 0
is_list = []
for i in range(len(kegg_gene_brite)):
    js_list = []
    for j in range(len(kegg_gene_brite[i]['BRITE']['BRITE_PATHS'])): 
        entries_path = kegg_gene_brite[i]['BRITE']['BRITE_PATHS'][j]
        if entries_path != []:
        
            temp = pd.DataFrame(entries_path)
            temp = temp.T
            temp['ENTRY'] = kegg_gene_brite[i]['ENTRY']+'_'+str(j)
            
            js_list = js_list + [temp]
            
    if js_list != []:
        is_list = is_list + [pd.concat(js_list)]
    

# is_list

BRITE_df = pd.concat(is_list)

BRITE_df = BRITE_df.drop_duplicates().reset_index().drop(columns = 'index')
BRITE_df
Out[ ]:
0 1 2 3 4 ENTRY 5 6
0 KEGG Orthology (KO) [BR:zma00001] 09180 Brite Hierarchies 09183 Protein families: signaling and cellular... 02000 Transporters [BR:zma02000] 100283122 100283122 CDS T01088_0 NaN NaN
1 Transporters [BR:zma02000] Solute carrier family (SLC) SLC50: Sugar efflux transporter 100283122 NaN 100283122 CDS T01088_1 NaN NaN
2 KEGG Orthology (KO) [BR:zma00001] 09180 Brite Hierarchies 09182 Protein families: genetic information pr... 03019 Messenger RNA biogenesis [BR:zma03019] 100384259 100384259 CDS T01088_0 NaN NaN
3 KEGG Orthology (KO) [BR:zma00001] 09180 Brite Hierarchies 09182 Protein families: genetic information pr... 03036 Chromosome and associated proteins [BR:z... 100384259 100384259 CDS T01088_1 NaN NaN
4 Messenger RNA biogenesis [BR:zma03019] Eukaryotic type mRNA surveillance and transport factors mRNA cycle factors Common to processing body (P body) and stress ... 100384259 CDS T01088_2 100384259 NaN
... ... ... ... ... ... ... ... ...
40927 Bacterial toxins [BR:zma02042] Type II toxins: Membrane damaging toxins Toxins that enzymatically damage the membrane 100384643 NaN 100384643 CDS T01088_5 NaN NaN
40928 KEGG Orthology (KO) [BR:zma00001] 09180 Brite Hierarchies 09183 Protein families: signaling and cellular... 02000 Transporters [BR:zma02000] 100384530 100384530 CDS T01088_0 NaN NaN
40929 Transporters [BR:zma02000] Other transporters Electrochemical potential-driven transporters ... 100384530 NaN 100384530 CDS T01088_1 NaN NaN
40930 KEGG Orthology (KO) [BR:zma00001] 09100 Metabolism 09105 Amino acid metabolism 00400 Phenylalanine, tyrosine and tryptophan b... 100284499 100284499 CDS T01088_0 NaN NaN
40931 Enzymes [BR:zma01000] 2. Transferases 2.5 Transferring alkyl or aryl groups, other ... 2.5.1 Transferring alkyl or aryl groups, othe... 2.5.1.54 3-deoxy-7-phosphoheptulonate synthase 100284499 CDS T01088_1 100284499 NaN

40932 rows × 8 columns

In [ ]:
#TODO find out what is causing levels deeper than 3 or the indices below (and others) to fail
fig = px.treemap(BRITE_df.loc[:
#     (
#     (BRITE_df.index != 7480) &
#     (BRITE_df.index != 8131) &
#     (BRITE_df.index != 8838) &
#     (BRITE_df.index != 8837) &
#     (BRITE_df.index != 8836)
# )
    , :], path=[px.Constant("all"), 0, 1, 2, 3, #4, 5, 6
            ], 
#                  values='a'
                )
fig.update_traces(root_color="lightgrey")
fig.update_layout(margin = dict(t=50, l=25, r=25, b=25))
fig.show()
In [ ]:
#| hide
import nbdev; nbdev.nbdev_export()